pSR646
AAV packaging plasmid expressing AAV2 Rep protein and SR646 capsid protein
pSR646 is a variation of AAV6, which provides a broader choice of pseudotype AAV vectors for gene therapy.
Mori, S., et al., Two novel adeno-associated viruses from cynomolgus monkey: pseudotyping characterization of capsid protein. Virology, 2004. 330(2): p. 375-383.
>pSR646
FNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQNSNICFTHGQKDCLECFPVSESQPVSVVKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQ
- If you are interested in our products, please click on the ‘Add to WishList’ button below;
- Please send your wishlist for details to [email protected] to get in touch with us；
Related products
-
Our Products
pAAV2.NN
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
TelN Protelomerase
Price range: $77.00 through $558.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAV rh.10
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAVYC5
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page
