pAAV-Rec2
AAV packaging plasmid expressing AAV2 Rep protein and AAV-Rec2 capsid protein
AAV-Rec2 (chimeric capsid of rh20 and AAV8) can transduce retinal tissue in mice and primates efficiently, although no more than AAV2/2 and rAAV2/5 serotypes.
Hollander, A.I.d.e.n., et al., Assessment of Tropism and Effectiveness of New Primate-Derived Hybrid Recombinant AAV Serotypes in the Mouse and Primate Retina. PLoS ONE, 2013. 8(4).
>pAAV-Rec2
MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLKAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVEEGAKTAPGKKRPVEPSPQRSPDSSTGIGKTGQQPAKKRLNFGQTGDSESVPDPQPIGEPPAGPSGLGSGTMAAGGGAPMADNNEGADGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGSTNDNTYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNEGTKTIANNLTSTIQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFEFSYQFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTQSTGGTAGTQQLLFSQAGPNNMSAQAKNWLPGPCYRQQRVSTTTGQNNNSNFAWTAGTKYHLNGRNSLANPGIAMATHKDDEERFFPSNGILIFGKQNAARDNADYSDVMLTSEEEIKTTNPVATEEYGIVADNLQQQNTAPQIGTVNSQGALPGMVWQNRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGLKHPPPQILIKNTPVPADPPTTFNQSKLNSFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSTSVDFAVNTEGVYSEPRPIGTRYLTRNL
- If you are interested in our products, please click on the ‘Add to WishList’ button below;
- Please send your wishlist for details to [email protected] to get in touch with us；
Related products
-
Our Products
pAAVhum.8
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAV-DB-3
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
TelN Protelomerase
Price range: $77.00 through $558.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAVVP2-N262
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page
