pAAV hu.40

AAV packaging plasmid expressing AAV2 Rep protein and AAAV hu.40 capsid protein

AAV hu.40 isolated from human tissue.

Gao G., et al. Clades of Adeno-associated viruses are widely disseminated in human tissues. J Virol. 2004.78(12):6381-6388.

>pAAV hu.40 

MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLKAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVEEAAKTAPGKKRPVEPSPQRSPDSSTGIGKKGQQPAKKRLSFGQTGDSESVPDPQPIGEPPAGPSGLGSGTMAAGGGAPMADNNEGADGVGSSSGNWHCDSTWLGDRVITT

  • If you are interested in our products, please click on the ‘Add to WishList’ button below;
  • Please send your wishlist for details to [email protected] to get in touch with us;

pAAV hu.40

Price range: $1,500.00 through $3,000.00

SKU: pAAV hu.40 Category:

Description

 

Additional information

Scale

5mg, 10mg

Scroll to Top