pAAV hu.40
AAV packaging plasmid expressing AAV2 Rep protein and AAAV hu.40 capsid protein
AAV hu.40 isolated from human tissue.
Gao G., et al. Clades of Adeno-associated viruses are widely disseminated in human tissues. J Virol. 2004.78(12):6381-6388.
>pAAV hu.40
MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLDKGEPVNAADAAALEHDKAYDQQLKAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVEEAAKTAPGKKRPVEPSPQRSPDSSTGIGKKGQQPAKKRLSFGQTGDSESVPDPQPIGEPPAGPSGLGSGTMAAGGGAPMADNNEGADGVGSSSGNWHCDSTWLGDRVITT
- If you are interested in our products, please click on the ‘Add to WishList’ button below;
- Please send your wishlist for details to [email protected] to get in touch with us；
Related products
-
Our Products
pAAV r2.15
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
TelN Protelomerase
Price range: $77.00 through $558.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAV2.NN
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAVhum.8
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page
