pAAV-NP59
AAV packaging plasmid expressing AAV2 Rep protein and AAV-NP59 capsid protein
capsid variants AAV-NP59 exhibit unique seroreactivity and significantly increase functional human hepatocyte transduction in vivo compared to existing hepatotropic serotypes.
Paulk, N.K., et al., Bioengineered AAV Capsids with Combined High Human Liver Transduction In Vivo and Unique Humoral Seroreactivity. Molecular Therapy, 2018. 26(1): p. 289-303.
>pAAV-NP59
MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGLVLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAYDRQLDSGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRVLEPLGLVEEPVKTAPGKKRPVEHSPVEPDSSSGTGKTGQQPAKKRLNFGQTGDSESVPDPQPLGEPPAAPSGLGTNTMATGSGAPMADNNEGADGVGNSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKKLSFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDIRDQSRNWLPGPCYRQQRVSKTSADNNNSEYSWAGATKYHLNGRDSLVNPGPAMASHKDDEEKFFPQSGVLIFGKQGSEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRGNRQAATADVDTQGVLPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRNL
- If you are interested in our products, please click on the ‘Add to WishList’ button below;
- Please send your wishlist for details to [email protected] to get in touch with us；
Related products
-
Our Products
pAAV DJ
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAV9.HR
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAV-PAL1C
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAV RC-C02
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page
