pAAV.k13
AAV packaging plasmid expressing AAV2 Rep protein and AAV.k13 capsid protein
AAV.k13 is a variation (452-MVEGRMG-458) of AAV9 capsid, which was enriched from the libraries following sequential intravenous cycling through mouse and pig kidneys, ex vivo cycling in human organoid cultures, and ex vivo machine perfusion in isolated kidneys from rhesus macaques.
Rosales, A., et al., Evolving adeno-associated viruses for gene transfer to the kidney via cross-species cycling of capsid libraries. Nature Biomedical Engineering, 2025. 9(7): p. 1086-1100.
>pAAV.k13
MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLDKGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTESVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISNSTSGGSSNDNAYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTDNNGVKTIANNLTSTVQVFTDSDYQLPYVLGSAHEGCLPPFPADVFMIPQYGYLTLNDGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYEFENVPFHSSYAHSQSLDRLMNPLIDQYLYYLSKTIMVEGRMGQTLKFSVAGPSNMAVQGRNYIPGPSYRQQRVSTTVTQNNNSEFAWPGASSWALNGRNSLMNPGPAMASHKEGEDRFFPLSGSLIFGKQGTGRDNVDADKVMITNEEEIKTTNPVATESYGQVATNHQSAQAQAQTGWVQNQGILPGMVWQDRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGMKHPPPQILIKNTPVPADPPTAFNKDKLNSFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFAVNTEGVYSEPRPIGTRYLTRNL*
- If you are interested in our products, please click on the ‘Add to WishList’ button below;
- Please send your wishlist for details to [email protected] to get in touch with us；
Related products
-
Our Products
pAAVVP2-N262
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pGalNAc-AAV2
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAV 4D-C102
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page -
Our Products
pAAV-DB-3
Price range: $1,500.00 through $3,000.00 Select options This product has multiple variants. The options may be chosen on the product page
